6 × 4/6 = 24 × 1/6

True
False

Answers

Answer 1

Answer:

True

Step-by-step explanation:

6 * 4/6 = 24 /6 = 24 * 1/6 = 4

This is  a true statement


Related Questions

Car Travels
In this new car your family can drive on a trip at 50 miles per hour. The
distance D you go is a of how many hours T you drive
function:d=50T if you drive for 125 miles how long would it take you to drive

Answers

125=50(t)
Divide both sides by 50
t=2.5 hours

- The length of a rectangle is 2 less than 5 times its width. The area of the rectangle is 39 km².
Find the length and width of the rectangle.

Answers

Answer:

Length is 13 and width is 3

Step-by-step explanation:

First find an equation that represents this situation.

39 = w * (5w-2)

This works because 39 (the total area) is w (the width) times 5w - 2 (the length). So solve for w.

39 = w * (5w-2)

First, distribute the w over the terms in parentheses

39 = 5w^2 - 2w

Then, subtract (5w^2 - 2w) from both sides.

39 - 5w^2 - 2w = 0

Factor the left side of the equation:

(−5w−13)(w−3)=0

Then set each factor equal to zero.

−5w−13 = 0

Add 13 to both sides, then divide both sides by -5 to isolate w. This leaves you with w = -13/5

Then the other factor:

w−3 = 0

Add 3 to both sides. You're left with w = 3.

So w is either -13/5, or 3. And since the width can't be negative, it is 3.

Now to find the height, plug 3 into the equation we had from earlier:

39 = w * (5w-2)

Substitute w into the equation:

39 = (3) * (5(3)-2)

39 = 3 * (15 - 2)

39 = 3 * (13)

Because 3 * 13 is equal, 13 is the length.

is 7.787878— a rational number?

Answers

Answer:

yes it is a rational number.

Step-by-step explanation:

Brawdy Plastics, Inc., produces plastic seat belt retainers for General Motors at their plant in Buffalo, New York. After final assembly and painting, the parts are placed on a conveyor belt that moves the parts past a final inspection station. How fast the parts move past the final inspection station depends upon the line speed of the conveyor belt (feet per minute). Although faster line speeds are desirable, management is concerned that increasing the line speed too much may not provide enough time for inspectors to identify which parts are actually defective. To test this theory, Brawdy Plastics conducted an experiment in which the same batch of parts, with a known number of defective parts, was inspected using a variety of line speeds. The following data were collected.

Line Speed Number of Defective Parts Found
20 23
20 21
30 19
30 16
40 15
40 17
50 14
50 11

Required:
a. Use the least squares method to develop the estimated regression equation (to 1 decimal).
b. Predict the number of defective parts found for a line speed of 25 feet per minute.

Answers

Answer:

a. y = 27.5 - 0.3X

b. 20

Step-by-step explanation:

y =  a + bX

usin the table in the attachment i added, we so for the regression equaion

n = 8

∑xy = 4460

∑x = 280

∑y = 136

∑x²= 10800

[tex]b=\frac{8(4460)-(280)(136)}{8(10800)-280^{2} } \\b=\frac{35680-38080}{86400-78400} \\b=\frac{-2400}{8000} \\b = -0.3[/tex]

from here we solve for a

[tex]a= \frac{136-(-0.3)(280)}{8} \\a =\frac{136+84}{8} \\a=\frac{220}{8} \\a = 27.5[/tex]

a. the estimated regression equation

y = 27.5 - 0.3X

b. at x = 25

y = 27.5 - 0.3(25)

y = 20 is the number of defective parts.

80 items were sold, bringing in $6,900 in receipts. Some items were sold at a discount for $75 each and some others were sold at full price for $90 each. How many were sold at discount and how many at full price?

Answers

Answer:

50 items were sold for $75

35 items were sold for $90

Step-by-step explanation:

75 x 50 = 3750

90 x 35 = 3150

3750 +3150 = 6,900


F

a
If
F
=
48
when
a
=
4
find,
a
when
F
=
60

Answers

Answer:

a=5

Step-by-step explanation:

Researchers for a company that manufactures batteries want to test the hypothesis that the mean battery life of their new battery is greater than the known mean battery life of their older version. The researchers selected random samples of 32 of the new batteries, subjected the batteries to continuous use, and determined the mean and standard deviation of the battery lives in the sample. Which of the following is an appropriate test for the researchers' hypothesis?

a. A one-sample z-test for a population mean.
b. A one-sample t-test for a population mean.
c. A one-sample z-test for a population proportion.
d. A matched-pairs t-test for a mean difference
e. A two-sample t-test for a difference between means

Answers

(b) one-sample t-test for a population mean

ur welcome :D

The most appropriate test to be used here would be a b. A one-sample t-test for a population mean.

Reasons to use one-sample t-test for a population mean.

One sample t-test is used when one wants to compare the mean of a population to another mean for statistical difference which is what the researchers hope to do here in comparing the mean battery life of a new battery to an old one.

A population mean will also be used because the population standard deviation is not given.

In conclusion, option B is correct.

Find out more on sample t-tests at https://brainly.com/question/6501190.

Use the drop-down boxes to show a function in the form y = mx + b for the line that contains the points (–6.4, –2.6) and (5.2, 9).

Answers

The equation in the slope-intercept form is y = x + 3.8

What is a slope?

In mathematics, a line's slope, also known as its gradient, is a numerical representation of the line's steepness and direction.

Given:

A line that contains the points (–6.4, –2.6) and (5.2, 9).

If a line passes through two points (x₁ ,y₁) and (x₂, y₂) ,

then the equation of line is

y - y₁ = (y₂- y₁) / (x₂ - x₁) x (x - x₁)

So, the equation,

y + 2.6 = {(9 + 2.6)/(5.2 + 6.4)} (x + 6.4)

y + 2.6 = x + 6.4

y = x + 6.4 - 2.6

y = x + 3.8

Therefore, the equation y = x + 3.8 is in the slope-intercept form.

To learn more about the slope;

brainly.com/question/3605446

#SPJ1

An Example of a caravan is
A. eight covered wagons travelings together on the trail
B. one covered wagon traveling by itself
C. a covered wagon passing a horse
D. a covered wagon traveling at top speed

Answers

An Example of a caravan is eight covered wagons traveling together on the trail. Meaning, option A is correct.

What is caravan?

A caravan, travel trailer, camper, tourer, or camper trailer is a trailer towed behind a road vehicle to provide a more comfortable and secure sleeping space than a tent.

It allows people to have their own home on a trip or vacation without relying on a motel or hotel, and it allows them to stay in places where none are available. However, in some countries, campers are restricted to designated sites where fees must be paid.

Caravans range from basic models that are little more than a tent on wheels to those that have several rooms with all of the furniture, furnishings, and equipment of a home. The solid-wall trailers can be made of metal or fibreglass.

Learn more about caravan

https://brainly.com/question/22851313

#SPJ1

I’ll mark brainlist
No links

Answers

The answers are 9/24 28/24

Answer:

3/8 = 9/24

7/6 = 28/24

Step-by-step explanation:

help me my future depends on it

Answers

Answer:

Step-by-step explanation:

if lx-2l=9 which of the following equal lx+3l?
A)4
B)7
C)8
D)10
E)11​

Answers

Answer:

D.10

Step-by-step explanation:

its check promise

egrbrbbrv

rbrvrbrvr

vrbrbrb

rbrbr

brbr

br

Hannah simplified the radical below and wants someone to check the work (view image)

Answers

Answer:

4|x|y²√(3yz)

She forgot the absolute value sign on x, and she left out the exponent on y.

Step-by-step explanation:

Step 1 is correct.

x may be positive, zero, or negative.

√x is always non-negative. To assure that √x² is non-negative, √x² = |x|.

√16 = 4

√3 = √3

√x² = |x|

√y² × √y² = √y^4 = y²

Since y² is always non-negative, there is no need for absolute value sign.

√y^4 = y²

Answer should be

4|x|y²√(3yz)

Determine the correct set up for solving the equation using the quadratic formula.

Answers

Answer: B

Begin by simplifying the given equation, so it's rearranged into standard form. Move all the terms onto one side, so they equal 0. This would result with [tex]4x^{2}[/tex]-3x-9=0. Quadratic formula is (-b±√(b²-4ac))/(2a). Standard form follow this variable format: [tex]ax^{2}[/tex]+bx+c. Use the numbers that correspond with each variable to substitute them into the quadratic formula. This would be

(-(-3)±√(-3²-4(4)(-9)/2(4).

A marketing executive surveyed 1,000 shoppers at a grocery store to determine the highest price shoppers are willing to pay for a gallon of ice cream. His data is show in the table.

Based on the data, of 10,000 shoppers, which BEST estimates the number of shoppers that would be willing to pay $8.00 for a gallon of ice cream.

If you cannot see, zoom in!

Don’t answer if you don’t know the answer. Whoever answers correctly will get Brainliest! :)

Answers

Answer:

C

Step-by-step explanation:

You multiply times 10

Below are graphs of several functions. Which functions have the specified domain and range ? There may be more than one correct answer

Answers

For the given value of domain and range , By observing the figure, The correct answer are options B,C and E.

What do you mean by function?

A function in mathematics from a set X to a set Y allocates exactly one element of Y to each element of X. The sets X and Y are collectively referred to as the function's domain and codomain, respectively. A mathematical phrase, rule, or law that establishes the link between an independent variable and a dependent variable (the dependent variable). In mathematics, functions exist everywhere, and they are crucial for constructing physical links in the sciences.

What are domain and range of the function?

A function's domain and range are the set of all possible inputs and outputs, respectively. A function's domain and range are crucial components. The range includes all of the function's output values, whereas the domain includes all potential input values from the set of real numbers.

domain : (x | x  3/2)

range : (-∞ , 2)

For these values, Option B , C and E holds that they exists when x  3/2 and it's output that is y exists between  (-∞ , 2).

To learn more about functions visit:

brainly.com/question/28193995

#SPJ1

of the 8 friends sitting around the table at lunch,6 brought their lunch from home.Which grid represents the percent of the friends brought their lunch from home

Answers

Answer:

6/8 =1.3333... or 33.3%

Step-by-step explanation:

Answer:

33.4 %

Is what I think I am not very sure but try it out hope this helped!

please answer in full process question
In the given figure l ||m and p || q. Find the measure of angles √1,2,3,4​

Answers

Step-by-step explanation:

angle 1=68°

angle 3 = 68°

angle 2= 180-68= 112°

angle 4 = 180-68= 112°

lil help here please

Answers

The answer is the last one (-20)

please answer quickly :)

Answers

Answer:

The solution is (-1, 0)

-----------------------------------

Given lines:

y = - 2x - 2 and y = x + 1

Plot both of the lines using the graphing calculator by adding the equations, then find the graphical solution as the intersection of the lines.

See attached.

The solution is (-1, 0).

What is the distance between the points (-4, 8) and (10,-3)?

Answers

Answer:

17.8

Step-by-step explanation:

Distance Formula: [tex]d=\sqrt{(x2-x1)^2+(y2-y1)^2}[/tex]

then plug it in

[tex]d=\sqrt{(10+4)^2+(-3-8)^2}[/tex]

then solve inside the parentheses

[tex]d=\sqrt{(14)^2+(-11)^2}[/tex]

then simplify

[tex]d=\sqrt{196+121}[/tex]

keep simplifying

[tex]d= \sqrt{317}[/tex]

solve the square root

[tex]d=17.80449381[/tex]

round

[tex]d=17.8[/tex]

y=3^n is an example of an exponential function.
True
False

Answers

Answer:

True

Step-by-step explanation:

A function of form y = a^n is an exponential function as long as a>0.

Original price of concert tickets: $101.00
Markup: 21%



What's the selling price of the concert tickets?

Answers

Answer:

122.21

Step-by-step explanation:

So our orginal value is 101 dollars,

Markup is increase in value.

The markup in this problem is 21%

We can thikn of this as 121%.

So to find the markup price, we must multiply 121% by 101.

We can thibk of 121% being myltiplying by 101 as:

1.21*101

This will get you:

122.21

So this is your answer!

Hope this helps! :)

Consider this right triangle with given measures.

What is the length of the unknown leg of the given right
triangle?
O 3ft
O vo ft
O 39 ft
O 89 ft


Answers

Answer:

[tex] \sqrt{39} [/tex]

Step-by-step explanation:

5

[tex]5 {}^{2} + x {}^{2} = 8 {}^{2} \\ 25 + x {}^{2} = 64 \\ x {}^{2} = 64 - 25 \\ x {}^{2} = 39 \\ x = \sqrt{39} [/tex]

The length of the unknown length is √39 ft if the other lengths are 5 ft and 8 ft in the right angle triangle.

What is a right-angle triangle?

It is defined as a triangle in which one angle is 90 degrees and the other two angles are acute angles. In a right-angled triangle, the name of the sides are hypotenuse, perpendicular, and base.

Let's suppose the unknown length is x ft

From the Pythagoras theorem:

[tex]\rm hypotenuse^2= perpendicular^2+ base^2[/tex]

[tex]8^2 = 5^2 +x^2[/tex]

64 = 25 + x²

x = √39 ft

Thus, the length of the unknown length is √39 ft if the other lengths are 5 ft and 8 ft in the right angle triangle.

Learn more about the right angle triangle here:

brainly.com/question/3770177

#SPJ2

Help me out with this please!

No links to suspicious sites other than Brainly!

Answers

Answer: E and F.

E:

4 * 4 * 4 = 64, and 64 = 64.

F:

-1 * -1 * -1 = 1, and 1 = 1

Find the equation of the line below. If necessary, use a slash ( / ) to indicate a division bar.

Answers

Answer:

y=4x

Step-by-step explanation:

Rise= 8

Run= 2

8/2 = 4/1 = 4

y=(slope)x+(y intercept)

y=4x+0

y=4x

y=4x

Please help me with this math question if u answer with no file link I will mark brainlist!!
A rectangle has coordinates W (1, -2), X (7,-2), Y (7,-6), and Z (1, -6).
The length of WXYZ is
units, and the width is
units.
7.6
7,2
6,4
5,3

Answers

Answer:

6, 4

Step-by-step explanation:

W to X : 7 - 1 = 6

W to Z : (-2) - (-6) = 4

Answer:

6,4

Step-by-step explanation:

One way is to calculate the distance between W and X, and X and Y to find the length and width.

The distance formula: [tex]d=\sqrt{(x_1-x_2)^2+(y_1-y_2)^2}[/tex]

plug W(1,-2) and X(7,-2) in to get the length

[tex]\sqrt{(1-7)^2+(-2-(-2))^2}=\sqrt{(-6)^2 +0^2}=\sqrt{36} =6[/tex]

plug X(7,-2) and Y(7,-6) to get the width

[tex]\sqrt{(7-7)^2+(-2-(-6))^2}=\sqrt{0^2 +4^2}=\sqrt{16} =4[/tex]

a) Find the total mass in kilograms of 3500 books, each with mass 800.
b) If the total mass of 8000 apples is 1.04 tonnes, what is the average mass of one apple?​

Answers

A) Total mass of 3500 books is 2,800 kilograms.

B) The average mass of one apple is 130 grams.

A) To find the total mass of 3500 books, each with a mass of 800 grams, we can multiply the number of books by the mass of each book:

Total mass = (3500 books) * (800 grams/book)

= 2,800,000 grams

= 2,800 kilograms

Therefore, the Total mass of 3500 books is 2,800 kilograms.

B) To find the average mass of one apple, we can divide the total mass of the apples by the number of apples:

Average mass = (1.04 tonnes) / (8000 apples)

= 130 grams/apple

Therefore, the average mass of one apple is 130 grams.

Learn more about average:

https://brainly.com/question/27193544

A 7,000-seat theater is interested in determining whether there is a difference in attendance between shows on Tuesday evening and those on Wednesday evening. Two independent samples of 31 weeks are collected for Tuesday and Wednesday. The mean attendance on Tuesday evening is calculated as 5,060, while the mean attendance on Wednesday evening is calculated as 5,390. The known population standard deviation for attendance on Tuesday evening is 540 and the known population standard deviation for attendance on Wednesday evening is 480. Which of the following is the appropriate conclusion at the 5% level of significance?

a. Conclude that the mean attendance differs since the p-value = 0.0067 < 0.05.
b. Conclude that the mean attendance differs since the p-value = 0.0134 < 0.05.
c. Do not conclude that the mean attendance differs since the p-value = 0.0067 < 0.05.
d. Do not conclude that the mean attendance differs since the p-value = 0.0134 < 0.05.

Answers

Answer:

b. Conclude that the mean attendance differs since the p-value = 0.0134 < 0.05.

Step-by-step explanation:

Before testing, we need to understand the central limit theorem and subtraction of normal variables.

Central Limit Theorem

The Central Limit Theorem estabilishes that, for a normally distributed random variable X, with mean [tex]\mu[/tex] and standard deviation [tex]\sigma[/tex], the sampling distribution of the sample means with size n can be approximated to a normal distribution with mean [tex]\mu[/tex] and standard deviation [tex]s = \frac{\sigma}{\sqrt{n}}[/tex].

For a skewed variable, the Central Limit Theorem can also be applied, as long as n is at least 30.

Subtraction between normal variables:

When two normal variables are subtracted, the mean is the difference of the means, while the standard deviation is the square root of the sum of the variances.

Samples of 31 weeks. The mean attendance on Tuesday evening is calculated as 5,060, with a population standard deviation of 540.

This means that:

[tex]\mu_{T} = 5060, s_T = \frac{540}{\sqrt{31}} = 97[/tex]

The mean attendance on Wednesday evening is calculated as 5,390, with standard deviation of 480.

This means that:

[tex]\mu_{W} = 5390, s_W = \frac{480}{\sqrt{31}} = 86.21[/tex]

A 7,000-seat theater is interested in determining whether there is a difference in attendance between shows on Tuesday evening and those on Wednesday evening.

At the null hypothesis we test if there is no difference, that is:

[tex]H_0: \mu_T - \mu_W = 0[/tex]

At the alternate hypothesis, we test if there is difference, that is:

[tex]H_a: \mu_T - \mu_W \neq 0[/tex]

The test statistic is:

[tex]z = \frac{X - \mu}{s}[/tex]

In which X is the sample mean, [tex]\mu[/tex] is the value tested at the null hypothesis and s is the standard error.

0 is tested at the null hypothesis:

This means that [tex]\mu = 0[/tex]

From the two samples collected:

[tex]X = \mu_T - \mu_W = 5060 - 5390 = -330[/tex]

[tex]s = \sqrt{s_T^2+s_W^2} = \sqrt{97^2+86.21^2} = 129.77[/tex]

Value of the test statistic:

[tex]z = \frac{X - \mu}{s}[/tex]

[tex]z = \frac{-330 - 0}{129.77}[/tex]

[tex]z = -2.54[/tex]

Pvalue of test and decision:

The pvalue of the test is finding the probability of the sample mean difference differing by 0 by at least 330, that is, P(|z| > 2.54), which is 2 multiplied by the pvalue of z = -2.54.

Looking at the z-table, z = -2.54 has a pvalue of 0.0067.

2*0.0067 = 0.0134

The pvalue of the test is 0.0134 < 0.05, which means that there is evidence that the mean attendance differs. The correct answer is given by option b.

Any help would be awesome

Answers

Answer: 72 square units

Step-by-step explanation: It is 72 square units because if you count the sides p and q you get 9 and the same with sides q and r you get 8 and if you multiply them together you get 72.

Other Questions
I dont understand and also any fake answers will be reported The US policy against the spread of communism was called The Truman Doctrine. True or False How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Dan drank 7/8 of a bottle of water During basketball practice. He then drank Another 4/8 of a bottle after practice. How much water did he drink altogether thats The Night is a big black catThe Moon is her topaz eye,The stars are the mice she hunts at night,In the field of the sultry skyIdentify a metaphor from the poem In a storeroom,there are 30 blue balls,48 green balls,some red balls and some white balls. there are 3 times as many green balls as red balls and 5 times as many blue balls as white balls.(a) How many balls are there altogether?(b) How many balls are left in the room if 7/10 (fraction) of the balls are taken away?pls help me answer both You've been asked to write an article for your school newspaper about the pros and cons of homework. What is ironic about this conversation the attorney thinks that there might be valuable evidence in the kitchen while? portia in act 3 is seen to be a typical women of the Elizabethan era. justify Steam Workshop Downloader